Placeholder image of a protein
Icon representing a puzzle

2496: Electron Density Reconstruction 101

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
August 09, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a reminder that DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGGTTACTCTTTAATGTAT ATACATTAAAGAGTAACCAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups


  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 47,868
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 45,822

  1. Avatar for KRUK94 51. KRUK94 Lv 1 1 pt. 46,489
  2. Avatar for carxo 52. carxo Lv 1 1 pt. 46,337
  3. Avatar for DScott 53. DScott Lv 1 1 pt. 46,280
  4. Avatar for bczero1 54. bczero1 Lv 1 1 pt. 46,110
  5. Avatar for Sammy3c2b1a0 55. Sammy3c2b1a0 Lv 1 1 pt. 45,822
  6. Avatar for furi0us 56. furi0us Lv 1 1 pt. 45,306
  7. Avatar for ProfVince 57. ProfVince Lv 1 1 pt. 44,569
  8. Avatar for Silverwolf75 58. Silverwolf75 Lv 1 1 pt. 44,492
  9. Avatar for apetrides 59. apetrides Lv 1 1 pt. 43,874
  10. Avatar for DipsyDoodle2016 60. DipsyDoodle2016 Lv 1 1 pt. 27,268

Comments