2496: Electron Density Reconstruction 101
Closed since over 1 year ago
Novice Overall Prediction Electron DensitySummary
- Created
- August 09, 2024
- Expires
- Max points
- 100
The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a reminder that DNA sidechains can be turned relative to their blue arms with bands.
- Sequence
- ACTGGTTACTCTTTAATGTAT ATACATTAAAGAGTAACCAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH
Top groups
-
100 pts. 51,126
-
-
-
-
-
-
-
-
-
