Placeholder image of a protein
Icon representing a puzzle

2499: Electron Density Reconstruction 102

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 14, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. It is a bit large, so the Trim tool may be necessary.

Sequence
NLLQFNKMIKEETGKNAIPFYAFYGCYCGGGGNGKPKDGTDRCCFVHDCCYGRLVNCNTKSDIYSYSLKEGYITCGKGTNCEEQICECDRVAAECFRRNLDTYNNGYMFYRDSKCTETSEEC

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 108,554
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 105,039
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 57,305
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 54,913
  5. Avatar for incognito group 15. incognito group 1 pt. 53,891

  1. Avatar for christioanchauvin 100 pts. 115,760
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 92 pts. 115,733
  3. Avatar for Galaxie 3. Galaxie Lv 1 85 pts. 115,681
  4. Avatar for gmn 4. gmn Lv 1 78 pts. 115,597
  5. Avatar for LociOiling 5. LociOiling Lv 1 71 pts. 115,558
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 65 pts. 115,492
  7. Avatar for Punzi Baker 3 7. Punzi Baker 3 Lv 1 60 pts. 115,445
  8. Avatar for grogar7 8. grogar7 Lv 1 54 pts. 115,406
  9. Avatar for fpc 9. fpc Lv 1 49 pts. 115,362
  10. Avatar for blazegeek 10. blazegeek Lv 1 45 pts. 115,263

Comments