Placeholder image of a protein
Icon representing a puzzle

2499: Electron Density Reconstruction 102

Closed since almost 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 14, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. It is a bit large, so the Trim tool may be necessary.

Sequence
NLLQFNKMIKEETGKNAIPFYAFYGCYCGGGGNGKPKDGTDRCCFVHDCCYGRLVNCNTKSDIYSYSLKEGYITCGKGTNCEEQICECDRVAAECFRRNLDTYNNGYMFYRDSKCTETSEEC

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 115,760
  2. Avatar for Go Science 2. Go Science 70 pts. 115,733
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 115,690
  4. Avatar for Contenders 4. Contenders 30 pts. 115,492
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 115,362
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 115,042
  7. Avatar for Australia 7. Australia 7 pts. 114,996
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 114,411
  9. Avatar for VeFold 9. VeFold 2 pts. 113,991
  10. Avatar for Russian team 10. Russian team 1 pt. 113,981

  1. Avatar for Portabello 61. Portabello Lv 1 1 pt. 53,891

Comments