Placeholder image of a protein
Icon representing a puzzle

2501: Refine Density Reconstruction 4

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
August 28, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2137, which was Reconstruction Puzzle 7, but now we have the Refine Density tool available to make folds even better! Learn about the new tool here: https://fold.it/forum/blog/new-tool-refine-density. This one won't allow loading solutions from that puzzle.

Sequence
TAAAKFERQHMDSPDLGTDDDDKAMADIGSDFMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEAHND

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 17,356
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 14,529
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 13,681

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 20,165
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 94 pts. 19,948
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 88 pts. 19,838
  4. Avatar for grogar7 4. grogar7 Lv 1 82 pts. 19,788
  5. Avatar for Bletchley Park 5. Bletchley Park Lv 1 76 pts. 19,761
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 71 pts. 19,592
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 66 pts. 19,574
  8. Avatar for Galaxie 8. Galaxie Lv 1 61 pts. 19,569
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 57 pts. 19,495
  10. Avatar for Zhang Ruichong 10. Zhang Ruichong Lv 1 53 pts. 19,416

Comments