2501: Refine Density Reconstruction 4
Closed since over 1 year ago
Novice Novice Overall Overall Prediction Prediction Electron Density Electron DensitySummary
- Created
- August 28, 2024
- Expires
- Max points
- 100
This is a protein we've given before in puzzle 2137, which was Reconstruction Puzzle 7, but now we have the Refine Density tool available to make folds even better! Learn about the new tool here: https://fold.it/forum/blog/new-tool-refine-density. This one won't allow loading solutions from that puzzle.
- Sequence
- TAAAKFERQHMDSPDLGTDDDDKAMADIGSDFMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEAHND
Top groups
-
100 pts. 20,171
-
-
-
-
-
-
-
-
-