Icon representing a puzzle

2502: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
August 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 10,404
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 10,101
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,652
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,008
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 93 pts. 10,943
  3. Avatar for Serca 3. Serca Lv 1 87 pts. 10,920
  4. Avatar for ichwilldiesennamen 4. ichwilldiesennamen Lv 1 80 pts. 10,874
  5. Avatar for Punzi Baker 3 5. Punzi Baker 3 Lv 1 74 pts. 10,856
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 69 pts. 10,851
  7. Avatar for gmn 7. gmn Lv 1 64 pts. 10,816
  8. Avatar for WBarme1234 8. WBarme1234 Lv 1 59 pts. 10,776
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 54 pts. 10,738
  10. Avatar for blazegeek 10. blazegeek Lv 1 50 pts. 10,736

Comments