Icon representing a puzzle

2502: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
August 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,008
  2. Avatar for Go Science 2. Go Science 65 pts. 10,920
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 41 pts. 10,776
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,681
  5. Avatar for Contenders 5. Contenders 14 pts. 10,680
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,606
  7. Avatar for Australia 7. Australia 4 pts. 10,572
  8. Avatar for VeFold 8. VeFold 2 pts. 10,565
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,557
  10. Avatar for Team China 10. Team China 1 pt. 10,524

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,007
  2. Avatar for Galaxie 2. Galaxie Lv 1 41 pts. 11,003
  3. Avatar for alcor29 3. alcor29 Lv 1 14 pts. 10,981
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 4 pts. 10,824
  5. Avatar for Th1sN@me!sN0tAPun 6. Th1sN@me!sN0tAPun Lv 1 1 pt. 10,504
  6. Avatar for JuliaBCollet 7. JuliaBCollet Lv 1 1 pt. 10,456

Comments