Icon representing a puzzle

2502: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,008
  2. Avatar for Go Science 2. Go Science 65 pts. 10,920
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 41 pts. 10,776
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,681
  5. Avatar for Contenders 5. Contenders 14 pts. 10,680
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,606
  7. Avatar for Australia 7. Australia 4 pts. 10,572
  8. Avatar for VeFold 8. VeFold 2 pts. 10,565
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,557
  10. Avatar for Team China 10. Team China 1 pt. 10,524

  1. Avatar for AlphaFold2 31. AlphaFold2 Lv 1 6 pts. 10,380
  2. Avatar for Th1sN@me!sN0tAPun 32. Th1sN@me!sN0tAPun Lv 1 5 pts. 10,371
  3. Avatar for davidoskky 33. davidoskky Lv 1 5 pts. 10,361
  4. Avatar for Vinara 34. Vinara Lv 1 4 pts. 10,360
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 4 pts. 10,350
  6. Avatar for Anfinsen_slept_here 36. Anfinsen_slept_here Lv 1 3 pts. 10,336
  7. Avatar for orily1337 37. orily1337 Lv 1 3 pts. 10,334
  8. Avatar for rosie4loop 38. rosie4loop Lv 1 2 pts. 10,323
  9. Avatar for Dr.Sillem 39. Dr.Sillem Lv 1 2 pts. 10,271
  10. Avatar for nicobul 40. nicobul Lv 1 2 pts. 10,231

Comments