Icon representing a puzzle

2505: Revisiting Puzzle 71: Crystallin

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
September 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,409
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 9,583
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,575
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,380
  5. Avatar for Street Smarts 15. Street Smarts 1 pt. 7,997

  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 11,260
  2. Avatar for toshiue 2. toshiue Lv 1 63 pts. 11,251
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 37 pts. 11,248
  4. Avatar for Galaxie 4. Galaxie Lv 1 21 pts. 11,245
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 11 pts. 11,235
  6. Avatar for LociOiling 6. LociOiling Lv 1 5 pts. 11,225
  7. Avatar for gmn 7. gmn Lv 1 2 pts. 11,216
  8. Avatar for alcor29 8. alcor29 Lv 1 1 pt. 11,216
  9. Avatar for JuliaBCollet 10. JuliaBCollet Lv 1 1 pt. 10,959

Comments