Icon representing a puzzle

2505: Revisiting Puzzle 71: Crystallin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
September 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,409
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 9,583
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,575
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,380
  5. Avatar for Street Smarts 15. Street Smarts 1 pt. 7,997
  1. Avatar for Hellcat6 31. Hellcat6 Lv 1 6 pts. 10,652
  2. Avatar for Alistair69 32. Alistair69 Lv 1 6 pts. 10,635
  3. Avatar for roarshock 33. roarshock Lv 1 5 pts. 10,625
  4. Avatar for hookedwarm 34. hookedwarm Lv 1 4 pts. 10,617
  5. Avatar for Th1sN@me!sN0tAPun 35. Th1sN@me!sN0tAPun Lv 1 4 pts. 10,557
  6. Avatar for AlphaFold2 36. AlphaFold2 Lv 1 3 pts. 10,547
  7. Avatar for sndampr314 37. sndampr314 Lv 1 3 pts. 10,448
  8. Avatar for frostschutz 38. frostschutz Lv 1 3 pts. 10,448
  9. Avatar for ProfVince 39. ProfVince Lv 1 2 pts. 10,445
  10. Avatar for TheGUmmer 40. TheGUmmer Lv 1 2 pts. 10,409

Comments