Icon representing a puzzle

2505: Revisiting Puzzle 71: Crystallin

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
September 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,409
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 9,583
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,575
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,380
  5. Avatar for Street Smarts 15. Street Smarts 1 pt. 7,997

  1. Avatar for nancy_naniewoo 41. nancy_naniewoo Lv 1 2 pts. 10,395
  2. Avatar for corvidcapsule 42. corvidcapsule Lv 1 2 pts. 10,311
  3. Avatar for Merf 43. Merf Lv 1 1 pt. 10,305
  4. Avatar for Trajan464 44. Trajan464 Lv 1 1 pt. 10,274
  5. Avatar for Vinara 45. Vinara Lv 1 1 pt. 10,247
  6. Avatar for Artoria2e5 46. Artoria2e5 Lv 1 1 pt. 10,165
  7. Avatar for SileNTViP 47. SileNTViP Lv 1 1 pt. 10,059
  8. Avatar for carxo 48. carxo Lv 1 1 pt. 10,039
  9. Avatar for DScott 49. DScott Lv 1 1 pt. 10,017
  10. Avatar for Mohoernchen 50. Mohoernchen Lv 1 1 pt. 9,975

Comments