Icon representing a puzzle

2505: Revisiting Puzzle 71: Crystallin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
September 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,409
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 9,583
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,575
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,380
  5. Avatar for Street Smarts 15. Street Smarts 1 pt. 7,997
  1. Avatar for heather-1 51. heather-1 Lv 1 1 pt. 9,937
  2. Avatar for SemperRabbit 52. SemperRabbit Lv 1 1 pt. 9,909
  3. Avatar for Funk3Beast 53. Funk3Beast Lv 1 1 pt. 9,875
  4. Avatar for rinze 54. rinze Lv 1 1 pt. 9,854
  5. Avatar for Kimdonghyeon 55. Kimdonghyeon Lv 1 1 pt. 9,849
  6. Avatar for abiogenesis 56. abiogenesis Lv 1 1 pt. 9,820
  7. Avatar for aCreativeUsername 57. aCreativeUsername Lv 1 1 pt. 9,786
  8. Avatar for KRUK94 58. KRUK94 Lv 1 1 pt. 9,683
  9. Avatar for mnnya 59. mnnya Lv 1 1 pt. 9,674
  10. Avatar for antibot215 60. antibot215 Lv 1 1 pt. 9,583

Comments