Icon representing a puzzle

2505: Revisiting Puzzle 71: Crystallin

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
September 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,409
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 9,583
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,575
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,380
  5. Avatar for Street Smarts 15. Street Smarts 1 pt. 7,997

  1. Avatar for Sammy3c2b1a0 61. Sammy3c2b1a0 Lv 1 1 pt. 9,575
  2. Avatar for mart0258 62. mart0258 Lv 1 1 pt. 9,557
  3. Avatar for Arne Heessels 63. Arne Heessels Lv 1 1 pt. 8,906
  4. Avatar for nicolo.gennari 64. nicolo.gennari Lv 1 1 pt. 8,672
  5. Avatar for rmoretti 65. rmoretti Lv 1 1 pt. 8,380
  6. Avatar for Will the pill 66. Will the pill Lv 1 1 pt. 7,997
  7. Avatar for Inka 67. Inka Lv 1 1 pt. 7,253
  8. Avatar for hamzanasfi 68. hamzanasfi Lv 1 1 pt. 6,983
  9. Avatar for toshiue 69. toshiue Lv 1 1 pt. 6,983
  10. Avatar for ctir123 70. ctir123 Lv 1 1 pt. 6,983

Comments