Icon representing a puzzle

2505: Revisiting Puzzle 71: Crystallin

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
September 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Go Science 100 pts. 11,263
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,245
  3. Avatar for Contenders 3. Contenders 47 pts. 11,168
  4. Avatar for Australia 4. Australia 30 pts. 11,145
  5. Avatar for Extraterrestrials 2.0 5. Extraterrestrials 2.0 19 pts. 11,053
  6. Avatar for VeFold 6. VeFold 11 pts. 10,973
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 10,945
  8. Avatar for Team China 8. Team China 4 pts. 10,851
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 2 pts. 10,821
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 1 pt. 10,791

  1. Avatar for Sammy3c2b1a0 61. Sammy3c2b1a0 Lv 1 1 pt. 9,575
  2. Avatar for mart0258 62. mart0258 Lv 1 1 pt. 9,557
  3. Avatar for Arne Heessels 63. Arne Heessels Lv 1 1 pt. 8,906
  4. Avatar for nicolo.gennari 64. nicolo.gennari Lv 1 1 pt. 8,672
  5. Avatar for rmoretti 65. rmoretti Lv 1 1 pt. 8,380
  6. Avatar for Will the pill 66. Will the pill Lv 1 1 pt. 7,997
  7. Avatar for Inka 67. Inka Lv 1 1 pt. 7,253
  8. Avatar for toshiue 68. toshiue Lv 1 1 pt. 6,983
  9. Avatar for hamzanasfi 69. hamzanasfi Lv 1 1 pt. 6,983
  10. Avatar for ctir123 70. ctir123 Lv 1 1 pt. 6,983

Comments