Placeholder image of a protein
Icon representing a puzzle

2517: Electron Density Reconstruction 103

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
September 26, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Previously, we had a puzzle in which there was a Hoogsteen base pair in this structure, but now it has a Watson-Crick base pair instead. Also, a useful note for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGGTTACTCTTTAATGTAT ATACATTAAAGAGTAACCAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 47,029
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 43,614
  3. Avatar for Street Smarts 13. Street Smarts 1 pt. 40,312

  1. Avatar for fpc 11. fpc Lv 1 44 pts. 50,236
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 40 pts. 50,231
  3. Avatar for toshiue 13. toshiue Lv 1 37 pts. 50,065
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 33 pts. 49,993
  5. Avatar for alcor29 15. alcor29 Lv 1 30 pts. 49,977
  6. Avatar for AlkiP0Ps 16. AlkiP0Ps Lv 1 27 pts. 49,745
  7. Avatar for JuliaBCollet 17. JuliaBCollet Lv 1 25 pts. 49,705
  8. Avatar for nicobul 18. nicobul Lv 1 22 pts. 49,700
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 20 pts. 49,672
  10. Avatar for BarrySampson 20. BarrySampson Lv 1 18 pts. 49,661

Comments


christioanchauvin Lv 1

I wonder if the comparison between this puzzle and the 2496 is valid.
Not only the type of base was changed,but also the dna was at the end for the 2496
and at the beginning for this puzzle.