Placeholder image of a protein
Icon representing a puzzle

2517: Electron Density Reconstruction 103

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
September 26, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Previously, we had a puzzle in which there was a Hoogsteen base pair in this structure, but now it has a Watson-Crick base pair instead. Also, a useful note for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGGTTACTCTTTAATGTAT ATACATTAAAGAGTAACCAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 47,029
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 43,614
  3. Avatar for Street Smarts 13. Street Smarts 1 pt. 40,312

  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 16 pts. 49,635
  2. Avatar for TheGUmmer 22. TheGUmmer Lv 1 15 pts. 49,633
  3. Avatar for akaaka 23. akaaka Lv 1 13 pts. 49,594
  4. Avatar for drumpeter18yrs9yrs 24. drumpeter18yrs9yrs Lv 1 12 pts. 49,559
  5. Avatar for roarshock 25. roarshock Lv 1 10 pts. 49,452
  6. Avatar for Anfinsen_slept_here 26. Anfinsen_slept_here Lv 1 9 pts. 49,259
  7. Avatar for Crossed Sticks 27. Crossed Sticks Lv 1 8 pts. 49,234
  8. Avatar for Idiotboy 28. Idiotboy Lv 1 7 pts. 49,206
  9. Avatar for maithra 29. maithra Lv 1 6 pts. 49,121
  10. Avatar for turbolag 30. turbolag Lv 1 6 pts. 49,087

Comments


christioanchauvin Lv 1

I wonder if the comparison between this puzzle and the 2496 is valid.
Not only the type of base was changed,but also the dna was at the end for the 2496
and at the beginning for this puzzle.