Placeholder image of a protein
Icon representing a puzzle

2517: Electron Density Reconstruction 103

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
September 26, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Previously, we had a puzzle in which there was a Hoogsteen base pair in this structure, but now it has a Watson-Crick base pair instead. Also, a useful note for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGGTTACTCTTTAATGTAT ATACATTAAAGAGTAACCAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 47,029
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 43,614
  3. Avatar for Street Smarts 13. Street Smarts 1 pt. 40,312

  1. Avatar for latin krepin 41. latin krepin Lv 1 1 pt. 48,034
  2. Avatar for nancy_naniewoo 42. nancy_naniewoo Lv 1 1 pt. 48,029
  3. Avatar for hada 43. hada Lv 1 1 pt. 47,880
  4. Avatar for pfirth 44. pfirth Lv 1 1 pt. 47,855
  5. Avatar for Th1sN@me!sN0tAPun 45. Th1sN@me!sN0tAPun Lv 1 1 pt. 47,824
  6. Avatar for Hellcat6 46. Hellcat6 Lv 1 1 pt. 47,810
  7. Avatar for meatexplosion 47. meatexplosion Lv 1 1 pt. 47,225
  8. Avatar for blazegeek 48. blazegeek Lv 1 1 pt. 47,151
  9. Avatar for Gerom 49. Gerom Lv 1 1 pt. 47,029
  10. Avatar for Merf 50. Merf Lv 1 1 pt. 46,590

Comments


christioanchauvin Lv 1

I wonder if the comparison between this puzzle and the 2496 is valid.
Not only the type of base was changed,but also the dna was at the end for the 2496
and at the beginning for this puzzle.