Placeholder image of a protein
Icon representing a puzzle

2517: Electron Density Reconstruction 103

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
September 26, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Previously, we had a puzzle in which there was a Hoogsteen base pair in this structure, but now it has a Watson-Crick base pair instead. Also, a useful note for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGGTTACTCTTTAATGTAT ATACATTAAAGAGTAACCAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 47,029
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 43,614
  3. Avatar for Street Smarts 13. Street Smarts 1 pt. 40,312
  1. Avatar for rinze 51. rinze Lv 1 1 pt. 46,403
  2. Avatar for DScott 52. DScott Lv 1 1 pt. 46,395
  3. Avatar for Mohoernchen 53. Mohoernchen Lv 1 1 pt. 46,382
  4. Avatar for Gargamerluzzo 54. Gargamerluzzo Lv 1 1 pt. 46,259
  5. Avatar for Artoria2e5 55. Artoria2e5 Lv 1 1 pt. 46,229
  6. Avatar for roshan 56. roshan Lv 1 1 pt. 46,056
  7. Avatar for carxo 57. carxo Lv 1 1 pt. 45,862
  8. Avatar for efull 58. efull Lv 1 1 pt. 45,712
  9. Avatar for Occasion 59. Occasion Lv 1 1 pt. 45,436
  10. Avatar for WuWTq 60. WuWTq Lv 1 1 pt. 44,387

Comments

christioanchauvin Lv 1

I wonder if the comparison between this puzzle and the 2496 is valid.
Not only the type of base was changed,but also the dna was at the end for the 2496
and at the beginning for this puzzle.