Placeholder image of a protein
Icon representing a puzzle

2517: Electron Density Reconstruction 103

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
September 26, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Previously, we had a puzzle in which there was a Hoogsteen base pair in this structure, but now it has a Watson-Crick base pair instead. Also, a useful note for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGGTTACTCTTTAATGTAT ATACATTAAAGAGTAACCAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 50,992
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 50,768
  3. Avatar for Go Science 3. Go Science 41 pts. 50,731
  4. Avatar for Contenders 4. Contenders 24 pts. 50,647
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 50,236
  6. Avatar for Australia 6. Australia 7 pts. 49,745
  7. Avatar for VeFold 7. VeFold 4 pts. 49,705
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 49,635
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 49,633
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 48,967

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 50,757
  2. Avatar for gmn 2. gmn Lv 1 41 pts. 50,736
  3. Avatar for toshiue 3. toshiue Lv 1 14 pts. 50,731
  4. Avatar for LociOiling 4. LociOiling Lv 1 4 pts. 50,728
  5. Avatar for alcor29 5. alcor29 Lv 1 1 pt. 50,618
  6. Avatar for bravosk8erboy 6. bravosk8erboy Lv 1 1 pt. 50,493
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 1 pt. 50,483

Comments


christioanchauvin Lv 1

I wonder if the comparison between this puzzle and the 2496 is valid.
Not only the type of base was changed,but also the dna was at the end for the 2496
and at the beginning for this puzzle.