Icon representing a puzzle

2516: Revisiting Puzzle 74: Platypus Venom

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,761
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,616
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,362
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,231
  1. Avatar for TheGUmmer
    1. TheGUmmer Lv 1
    100 pts. 9,742
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 9,738
  3. Avatar for bravosk8erboy 3. bravosk8erboy Lv 1 88 pts. 9,728
  4. Avatar for grogar7 4. grogar7 Lv 1 83 pts. 9,726
  5. Avatar for gmn 5. gmn Lv 1 77 pts. 9,695
  6. Avatar for ichwilldiesennamen 6. ichwilldiesennamen Lv 1 72 pts. 9,693
  7. Avatar for BarrySampson 7. BarrySampson Lv 1 68 pts. 9,683
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 63 pts. 9,675
  9. Avatar for akaaka 9. akaaka Lv 1 59 pts. 9,634
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 55 pts. 9,614

Comments