Icon representing a puzzle

2519: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 09, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 9,819
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,750
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,140
  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 10,178
  2. Avatar for gmn 2. gmn Lv 1 95 pts. 10,175
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 89 pts. 10,172
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 84 pts. 10,155
  5. Avatar for Aubade01 5. Aubade01 Lv 1 79 pts. 10,140
  6. Avatar for ichwilldiesennamen 6. ichwilldiesennamen Lv 1 74 pts. 10,139
  7. Avatar for LociOiling 7. LociOiling Lv 1 70 pts. 10,137
  8. Avatar for christioanchauvin 8. christioanchauvin Lv 1 66 pts. 10,137
  9. Avatar for blazegeek 9. blazegeek Lv 1 62 pts. 10,120
  10. Avatar for BootsMcGraw 10. BootsMcGraw Lv 1 58 pts. 10,092

Comments