Icon representing a puzzle

2531: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 06, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,607
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,794
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,468
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 7,976
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 7,660
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 3,334
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,264
  2. Avatar for grogar7 2. grogar7 Lv 1 95 pts. 10,188
  3. Avatar for bravosk8erboy 3. bravosk8erboy Lv 1 89 pts. 10,182
  4. Avatar for ichwilldiesennamen 4. ichwilldiesennamen Lv 1 84 pts. 10,159
  5. Avatar for Galaxie 5. Galaxie Lv 1 79 pts. 10,100
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 74 pts. 10,054
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 70 pts. 10,047
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 66 pts. 10,015
  9. Avatar for gmn 9. gmn Lv 1 62 pts. 10,006
  10. Avatar for fpc 10. fpc Lv 1 58 pts. 9,993

Comments