Icon representing a puzzle

2531: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 06, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,266
  2. Avatar for Go Science 2. Go Science 71 pts. 10,183
  3. Avatar for Contenders 3. Contenders 49 pts. 10,054
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,993
  5. Avatar for VeFold 5. VeFold 22 pts. 9,940
  6. Avatar for Australia 6. Australia 14 pts. 9,929
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,926
  8. Avatar for I-14 Salt Bridges 8. I-14 Salt Bridges 5 pts. 9,921
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,917
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 2 pts. 9,885
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,266
  2. Avatar for LociOiling 2. LociOiling Lv 1 33 pts. 10,265
  3. Avatar for alcor29 3. alcor29 Lv 1 8 pts. 10,226
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 2 pts. 10,183
  5. Avatar for toshiue 5. toshiue Lv 1 1 pt. 10,178
  6. Avatar for meatexplosion 6. meatexplosion Lv 1 1 pt. 9,598

Comments