Icon representing a puzzle

2531: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 1 year ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 06, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,266
  2. Avatar for Go Science 2. Go Science 71 pts. 10,183
  3. Avatar for Contenders 3. Contenders 49 pts. 10,054
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,993
  5. Avatar for VeFold 5. VeFold 22 pts. 9,940
  6. Avatar for Australia 6. Australia 14 pts. 9,929
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,926
  8. Avatar for I-14 Salt Bridges 8. I-14 Salt Bridges 5 pts. 9,921
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,917
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 2 pts. 9,885

  1. Avatar for playrix 61. playrix Lv 1 1 pt. 8,573
  2. Avatar for KRUK94 62. KRUK94 Lv 1 1 pt. 8,553
  3. Avatar for sftgfop1 63. sftgfop1 Lv 1 1 pt. 8,532
  4. Avatar for nancy_naniewoo 64. nancy_naniewoo Lv 1 1 pt. 8,476
  5. Avatar for alyssa_d_V2.0 65. alyssa_d_V2.0 Lv 1 1 pt. 8,468
  6. Avatar for MsHsi 66. MsHsi Lv 1 1 pt. 8,368
  7. Avatar for rinze 67. rinze Lv 1 1 pt. 8,306
  8. Avatar for goldfish80 68. goldfish80 Lv 1 1 pt. 8,273
  9. Avatar for RWoodcock 69. RWoodcock Lv 1 1 pt. 8,246
  10. Avatar for frostschutz 70. frostschutz Lv 1 1 pt. 8,180

Comments