Icon representing a puzzle

2531: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 06, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,266
  2. Avatar for Go Science 2. Go Science 71 pts. 10,183
  3. Avatar for Contenders 3. Contenders 49 pts. 10,054
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,993
  5. Avatar for VeFold 5. VeFold 22 pts. 9,940
  6. Avatar for Australia 6. Australia 14 pts. 9,929
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,926
  8. Avatar for I-14 Salt Bridges 8. I-14 Salt Bridges 5 pts. 9,921
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,917
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 2 pts. 9,885
  1. Avatar for Merf 71. Merf Lv 1 1 pt. 8,065
  2. Avatar for ivalnic 72. ivalnic Lv 1 1 pt. 8,042
  3. Avatar for shcawthon 73. shcawthon Lv 1 1 pt. 7,976
  4. Avatar for WuWTq 74. WuWTq Lv 1 1 pt. 7,860
  5. Avatar for Neil0615 75. Neil0615 Lv 1 1 pt. 7,822
  6. Avatar for sse20 76. sse20 Lv 1 1 pt. 7,808
  7. Avatar for efull 77. efull Lv 1 1 pt. 7,780
  8. Avatar for pro_stealth 78. pro_stealth Lv 1 1 pt. 7,759
  9. Avatar for futsall 79. futsall Lv 1 1 pt. 7,758
  10. Avatar for MosieMaster 80. MosieMaster Lv 1 1 pt. 7,756

Comments