Icon representing a puzzle

2534: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 13, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,889
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,789
  3. Avatar for Androids 13. Androids 1 pt. 9,276
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,952
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 95 pts. 10,806
  3. Avatar for grogar7 3. grogar7 Lv 1 90 pts. 10,748
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 84 pts. 10,702
  5. Avatar for TheGUmmer 5. TheGUmmer Lv 1 80 pts. 10,668
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 75 pts. 10,654
  7. Avatar for Galaxie 7. Galaxie Lv 1 70 pts. 10,636
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 66 pts. 10,613
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 62 pts. 10,532
  10. Avatar for bravosk8erboy 10. bravosk8erboy Lv 1 58 pts. 10,528

Comments