Icon representing a puzzle

2534: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 1 year ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 13, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,982
  2. Avatar for Go Science 2. Go Science 65 pts. 10,806
  3. Avatar for Void Crushers 3. Void Crushers 41 pts. 10,668
  4. Avatar for Contenders 4. Contenders 24 pts. 10,654
  5. Avatar for Australia 5. Australia 14 pts. 10,526
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,483
  7. Avatar for VeFold 7. VeFold 4 pts. 10,405
  8. Avatar for Marvin's bunch 8. Marvin's bunch 2 pts. 10,354
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,325
  10. Avatar for I-14 Salt Bridges 10. I-14 Salt Bridges 1 pt. 10,001

  1. Avatar for furi0us 81. furi0us Lv 1 1 pt. 8,882
  2. Avatar for SereenIdries 82. SereenIdries Lv 1 1 pt. 8,747
  3. Avatar for TOAD_samurai 83. TOAD_samurai Lv 1 1 pt. 8,726
  4. Avatar for tpmanjr 84. tpmanjr Lv 1 1 pt. 8,719
  5. Avatar for Fanhao 85. Fanhao Lv 1 1 pt. 8,675
  6. Avatar for MosieMaster 86. MosieMaster Lv 1 1 pt. 8,621
  7. Avatar for lickington 87. lickington Lv 1 1 pt. 8,545
  8. Avatar for Francesco Borsato 88. Francesco Borsato Lv 1 1 pt. 4,734

Comments