Icon representing a puzzle

2537: Revisiting Puzzle 82: Cytotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 20, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,257
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 7,501
  3. Avatar for I-14 Salt Bridges 13. I-14 Salt Bridges 1 pt. 7,496
  4. Avatar for Androids 14. Androids 1 pt. 7,480
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,387
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 94 pts. 10,370
  3. Avatar for bravosk8erboy 3. bravosk8erboy Lv 1 88 pts. 10,334
  4. Avatar for grogar7 4. grogar7 Lv 1 82 pts. 10,332
  5. Avatar for blazegeek 5. blazegeek Lv 1 77 pts. 10,324
  6. Avatar for Galaxie 6. Galaxie Lv 1 72 pts. 10,270
  7. Avatar for TheGUmmer 7. TheGUmmer Lv 1 67 pts. 10,189
  8. Avatar for dcrwheeler 8. dcrwheeler Lv 1 62 pts. 10,174
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 58 pts. 10,152
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 54 pts. 10,052

Comments