Icon representing a puzzle

2537: Revisiting Puzzle 82: Cytotoxin

Closed since over 1 year ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 20, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,387
  2. Avatar for Go Science 2. Go Science 68 pts. 10,370
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,189
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,052
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,011
  6. Avatar for VeFold 6. VeFold 9 pts. 10,005
  7. Avatar for Contenders 7. Contenders 5 pts. 9,942
  8. Avatar for Australia 8. Australia 3 pts. 9,936
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,674
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 9,467

  1. Avatar for carxo 51. carxo Lv 1 1 pt. 8,602
  2. Avatar for DScott 52. DScott Lv 1 1 pt. 8,588
  3. Avatar for apetrides 53. apetrides Lv 1 1 pt. 8,587
  4. Avatar for Trajan464 54. Trajan464 Lv 1 1 pt. 8,506
  5. Avatar for RWoodcock 55. RWoodcock Lv 1 1 pt. 8,445
  6. Avatar for Auntecedent 56. Auntecedent Lv 1 1 pt. 8,373
  7. Avatar for zo3xiaJonWeinberg 57. zo3xiaJonWeinberg Lv 1 1 pt. 8,257
  8. Avatar for orily1337 58. orily1337 Lv 1 1 pt. 8,213
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 8,184
  10. Avatar for frostschutz 60. frostschutz Lv 1 1 pt. 8,077

Comments