Placeholder image of a protein
Icon representing a puzzle

2545: Refine Density Reconstruction 16

Closed since over 1 year ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density

Summary

Created
November 21, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2300, which was Reconstruction Puzzle 39, but now we have the Refine Density tool available to make folds even better!

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 13,267
  2. Avatar for Team China 12. Team China 1 pt. 13,169
  3. Avatar for Street Smarts 13. Street Smarts 1 pt. 12,467
  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 14,233
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 93 pts. 13,965
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 86 pts. 13,917
  4. Avatar for meatexplosion 4. meatexplosion Lv 1 79 pts. 13,900
  5. Avatar for gmn 5. gmn Lv 1 73 pts. 13,886
  6. Avatar for LociOiling 6. LociOiling Lv 1 67 pts. 13,875
  7. Avatar for BootsMcGraw 7. BootsMcGraw Lv 1 61 pts. 13,826
  8. Avatar for WBarme1234 8. WBarme1234 Lv 1 56 pts. 13,816
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 51 pts. 13,815
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 47 pts. 13,794

Comments