2545: Refine Density Reconstruction 16
Closed since over 1 year ago
Novice Novice Overall Overall Prediction Prediction Electron Density Electron DensitySummary
- Created
- November 21, 2024
- Expires
- Max points
- 100
This is a protein we've given before in puzzle 2300, which was Reconstruction Puzzle 39, but now we have the Refine Density tool available to make folds even better!
- Sequence
- GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR