Placeholder image of a protein
Icon representing a puzzle

2545: Refine Density Reconstruction 16

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
November 21, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2300, which was Reconstruction Puzzle 39, but now we have the Refine Density tool available to make folds even better!

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,234
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 13,965
  3. Avatar for Contenders 3. Contenders 41 pts. 13,917
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 13,902
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 13,816
  6. Avatar for Australia 6. Australia 7 pts. 13,743
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 13,687
  8. Avatar for VeFold 8. VeFold 2 pts. 13,686
  9. Avatar for Russian team 9. Russian team 1 pt. 13,439
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 13,269
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 14,234
  2. Avatar for Anfinsen_slept_here 2. Anfinsen_slept_here Lv 1 41 pts. 14,112
  3. Avatar for Galaxie 3. Galaxie Lv 1 14 pts. 13,902
  4. Avatar for LociOiling 4. LociOiling Lv 1 4 pts. 13,902
  5. Avatar for alcor29 5. alcor29 Lv 1 1 pt. 13,881
  6. Avatar for bravosk8erboy 6. bravosk8erboy Lv 1 1 pt. 13,841
  7. Avatar for jamiexq 7. jamiexq Lv 1 1 pt. 13,092

Comments