Placeholder image of a protein
Icon representing a puzzle

2545: Refine Density Reconstruction 16

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
November 21, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2300, which was Reconstruction Puzzle 39, but now we have the Refine Density tool available to make folds even better!

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups


  1. Avatar for Go Science 100 pts. 14,234
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 13,965
  3. Avatar for Contenders 3. Contenders 41 pts. 13,917
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 13,902
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 13,816
  6. Avatar for Australia 6. Australia 7 pts. 13,743
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 13,687
  8. Avatar for VeFold 8. VeFold 2 pts. 13,686
  9. Avatar for Russian team 9. Russian team 1 pt. 13,439
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 13,269

  1. Avatar for Crossed Sticks 21. Crossed Sticks Lv 1 15 pts. 13,602
  2. Avatar for dcrwheeler 22. dcrwheeler Lv 1 14 pts. 13,596
  3. Avatar for zbp 23. zbp Lv 1 12 pts. 13,568
  4. Avatar for alcor29 24. alcor29 Lv 1 11 pts. 13,558
  5. Avatar for orily1337 25. orily1337 Lv 1 10 pts. 13,552
  6. Avatar for Trajan464 26. Trajan464 Lv 1 8 pts. 13,523
  7. Avatar for Hellcat6 27. Hellcat6 Lv 1 7 pts. 13,461
  8. Avatar for pizpot 28. pizpot Lv 1 7 pts. 13,459
  9. Avatar for Anfinsen_slept_here 29. Anfinsen_slept_here Lv 1 6 pts. 13,455
  10. Avatar for ProfVince 30. ProfVince Lv 1 5 pts. 13,443

Comments