Placeholder image of a protein
Icon representing a puzzle

2545: Refine Density Reconstruction 16

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
November 21, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2300, which was Reconstruction Puzzle 39, but now we have the Refine Density tool available to make folds even better!

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups


  1. Avatar for Go Science 100 pts. 14,234
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 13,965
  3. Avatar for Contenders 3. Contenders 41 pts. 13,917
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 13,902
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 13,816
  6. Avatar for Australia 6. Australia 7 pts. 13,743
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 13,687
  8. Avatar for VeFold 8. VeFold 2 pts. 13,686
  9. Avatar for Russian team 9. Russian team 1 pt. 13,439
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 13,269

  1. Avatar for Gerom 31. Gerom Lv 1 4 pts. 13,439
  2. Avatar for rosie4loop 32. rosie4loop Lv 1 4 pts. 13,385
  3. Avatar for hookedwarm 33. hookedwarm Lv 1 3 pts. 13,369
  4. Avatar for abiogenesis 34. abiogenesis Lv 1 3 pts. 13,358
  5. Avatar for nicobul 35. nicobul Lv 1 3 pts. 13,343
  6. Avatar for carxo 36. carxo Lv 1 2 pts. 13,321
  7. Avatar for Mohoernchen 37. Mohoernchen Lv 1 2 pts. 13,306
  8. Avatar for Th1sN@me!sN0tAPun 38. Th1sN@me!sN0tAPun Lv 1 2 pts. 13,292
  9. Avatar for Joanna_H 39. Joanna_H Lv 1 1 pt. 13,269
  10. Avatar for TheGUmmer 40. TheGUmmer Lv 1 1 pt. 13,267

Comments