Icon representing a puzzle

2540: Revisiting Puzzle 83: Cardiotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 27, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Andrew's Foldit group 11. Andrew's Foldit group 1 pt. 7,247
  2. Avatar for CBME5920_2022 12. CBME5920_2022 1 pt. 7,178
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 7,110
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 0
  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 10,374
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 10,349
  3. Avatar for meatexplosion 3. meatexplosion Lv 1 88 pts. 10,307
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 82 pts. 10,304
  5. Avatar for blazegeek 5. blazegeek Lv 1 77 pts. 10,295
  6. Avatar for gmn 6. gmn Lv 1 72 pts. 10,253
  7. Avatar for akaaka 7. akaaka Lv 1 67 pts. 10,240
  8. Avatar for christioanchauvin 8. christioanchauvin Lv 1 63 pts. 10,230
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 58 pts. 10,166
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 54 pts. 10,160

Comments