Icon representing a puzzle

2543: Revisiting Puzzle 84: Giant Anemone

Closed since over 1 year ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
December 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 8,573
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,323
  3. Avatar for Coastal Biochemistry 13. Coastal Biochemistry 1 pt. 7,618
  4. Avatar for BC125 - G9 14. BC125 - G9 1 pt. 5,437

  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 9,879
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 9,875
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 87 pts. 9,864
  4. Avatar for blazegeek 4. blazegeek Lv 1 81 pts. 9,843
  5. Avatar for grogar7 5. grogar7 Lv 1 75 pts. 9,823
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 70 pts. 9,819
  7. Avatar for TheGUmmer 7. TheGUmmer Lv 1 64 pts. 9,771
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 60 pts. 9,684
  9. Avatar for gmn 9. gmn Lv 1 55 pts. 9,672
  10. Avatar for BarrySampson 10. BarrySampson Lv 1 51 pts. 9,651

Comments