Icon representing a puzzle

2543: Revisiting Puzzle 84: Giant Anemone

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
December 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,573
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,323
  3. Avatar for Coastal Biochemistry 13. Coastal Biochemistry 1 pt. 7,618
  4. Avatar for BC125 - G9 14. BC125 - G9 1 pt. 5,437
  1. Avatar for WBarme1234 11. WBarme1234 Lv 1 47 pts. 9,646
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 43 pts. 9,586
  3. Avatar for Punzi Baker 3 13. Punzi Baker 3 Lv 1 40 pts. 9,575
  4. Avatar for Aubade01 14. Aubade01 Lv 1 36 pts. 9,567
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 33 pts. 9,550
  6. Avatar for Galaxie 16. Galaxie Lv 1 30 pts. 9,542
  7. Avatar for fpc 17. fpc Lv 1 28 pts. 9,537
  8. Avatar for meatexplosion 18. meatexplosion Lv 1 25 pts. 9,531
  9. Avatar for Hellcat6 19. Hellcat6 Lv 1 23 pts. 9,506
  10. Avatar for georg137 20. georg137 Lv 1 21 pts. 9,493

Comments