Icon representing a puzzle

2543: Revisiting Puzzle 84: Giant Anemone

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
December 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 8,573
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,323
  3. Avatar for Coastal Biochemistry 13. Coastal Biochemistry 1 pt. 7,618
  4. Avatar for BC125 - G9 14. BC125 - G9 1 pt. 5,437

  1. Avatar for carxo 41. carxo Lv 1 2 pts. 8,665
  2. Avatar for jamiexq 42. jamiexq Lv 1 2 pts. 8,580
  3. Avatar for zo3xiaJonWeinberg 43. zo3xiaJonWeinberg Lv 1 2 pts. 8,573
  4. Avatar for Mohoernchen 44. Mohoernchen Lv 1 1 pt. 8,500
  5. Avatar for DScott 45. DScott Lv 1 1 pt. 8,435
  6. Avatar for audrec 46. audrec Lv 1 1 pt. 8,372
  7. Avatar for haleyg 47. haleyg Lv 1 1 pt. 8,351
  8. Avatar for Savas 48. Savas Lv 1 1 pt. 8,323
  9. Avatar for froschi2 49. froschi2 Lv 1 1 pt. 8,295
  10. Avatar for rinze 50. rinze Lv 1 1 pt. 8,280

Comments