Icon representing a puzzle

2543: Revisiting Puzzle 84: Giant Anemone

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
December 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 8,573
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,323
  3. Avatar for Coastal Biochemistry 13. Coastal Biochemistry 1 pt. 7,618
  4. Avatar for BC125 - G9 14. BC125 - G9 1 pt. 5,437

  1. Avatar for zbp 51. zbp Lv 1 1 pt. 8,214
  2. Avatar for ProfVince 52. ProfVince Lv 1 1 pt. 8,148
  3. Avatar for AlphaFold2 53. AlphaFold2 Lv 1 1 pt. 8,142
  4. Avatar for Trajan464 54. Trajan464 Lv 1 1 pt. 8,103
  5. Avatar for Subin Ryu 55. Subin Ryu Lv 1 1 pt. 7,859
  6. Avatar for JustinRothganger 56. JustinRothganger Lv 1 1 pt. 7,660
  7. Avatar for futsall 57. futsall Lv 1 1 pt. 7,655
  8. Avatar for mrliscian 58. mrliscian Lv 1 1 pt. 7,618
  9. Avatar for DrAeroplane 59. DrAeroplane Lv 1 1 pt. 7,592
  10. Avatar for Vinara 60. Vinara Lv 1 1 pt. 7,590

Comments