Icon representing a puzzle

2543: Revisiting Puzzle 84: Giant Anemone

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
December 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 8,573
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,323
  3. Avatar for Coastal Biochemistry 13. Coastal Biochemistry 1 pt. 7,618
  4. Avatar for BC125 - G9 14. BC125 - G9 1 pt. 5,437

  1. Avatar for Szubix 61. Szubix Lv 1 1 pt. 7,565
  2. Avatar for Suthiwat 62. Suthiwat Lv 1 1 pt. 7,446
  3. Avatar for IdfbAn 63. IdfbAn Lv 1 1 pt. 7,444
  4. Avatar for Kineticcat_ 64. Kineticcat_ Lv 1 1 pt. 7,407
  5. Avatar for furi0us 65. furi0us Lv 1 1 pt. 7,401
  6. Avatar for happyquokka 66. happyquokka Lv 1 1 pt. 7,379
  7. Avatar for aeroplanezz 69. aeroplanezz Lv 1 1 pt. 5,437
  8. Avatar for yanisa 70. yanisa Lv 1 1 pt. 4,101

Comments