Icon representing a puzzle

2549: Revisiting Puzzle 86: Nematode

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
December 18, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,421
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,219
  3. Avatar for Team China 13. Team China 1 pt. 8,044
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,725
  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 11,459
  2. Avatar for LociOiling 2. LociOiling Lv 1 93 pts. 11,367
  3. Avatar for Serca 3. Serca Lv 1 86 pts. 11,272
  4. Avatar for BootsMcGraw 4. BootsMcGraw Lv 1 79 pts. 11,206
  5. Avatar for Punzi Baker 3 5. Punzi Baker 3 Lv 1 73 pts. 11,006
  6. Avatar for akaaka 6. akaaka Lv 1 68 pts. 10,995
  7. Avatar for gmn 7. gmn Lv 1 62 pts. 10,988
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 57 pts. 10,986
  9. Avatar for meatexplosion 9. meatexplosion Lv 1 52 pts. 10,979
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 48 pts. 10,978

Comments