Icon representing a puzzle

2549: Revisiting Puzzle 86: Nematode

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
December 18, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Go Science 100 pts. 11,459
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,372
  3. Avatar for Contenders 3. Contenders 44 pts. 11,206
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,953
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 10,644
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,610
  7. Avatar for Australia 7. Australia 5 pts. 10,558
  8. Avatar for VeFold 8. VeFold 3 pts. 10,435
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,370
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 8,906

  1. Avatar for orily1337 11. orily1337 Lv 1 44 pts. 10,953
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 40 pts. 10,885
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 37 pts. 10,836
  4. Avatar for grogar7 14. grogar7 Lv 1 33 pts. 10,835
  5. Avatar for Galaxie 15. Galaxie Lv 1 30 pts. 10,762
  6. Avatar for alcor29 16. alcor29 Lv 1 27 pts. 10,722
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 25 pts. 10,644
  8. Avatar for g_b 18. g_b Lv 1 22 pts. 10,632
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 20 pts. 10,610
  10. Avatar for heather-1 20. heather-1 Lv 1 18 pts. 10,564

Comments