Icon representing a puzzle

2549: Revisiting Puzzle 86: Nematode

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
December 18, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Go Science 100 pts. 11,459
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,372
  3. Avatar for Contenders 3. Contenders 44 pts. 11,206
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,953
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 10,644
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,610
  7. Avatar for Australia 7. Australia 5 pts. 10,558
  8. Avatar for VeFold 8. VeFold 3 pts. 10,435
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,370
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 8,906

  1. Avatar for manu8170 31. manu8170 Lv 1 5 pts. 9,837
  2. Avatar for Hellcat6 32. Hellcat6 Lv 1 4 pts. 9,526
  3. Avatar for Hexafluorouranate 33. Hexafluorouranate Lv 1 4 pts. 9,272
  4. Avatar for Crossed Sticks 34. Crossed Sticks Lv 1 3 pts. 9,151
  5. Avatar for Larini 35. Larini Lv 1 3 pts. 9,112
  6. Avatar for carxo 36. carxo Lv 1 3 pts. 9,088
  7. Avatar for abiogenesis 37. abiogenesis Lv 1 2 pts. 8,962
  8. Avatar for antibot215 38. antibot215 Lv 1 2 pts. 8,906
  9. Avatar for Jenot96 39. Jenot96 Lv 1 2 pts. 8,905
  10. Avatar for RichGuilmain 40. RichGuilmain Lv 1 2 pts. 8,871

Comments