Icon representing a puzzle

2549: Revisiting Puzzle 86: Nematode

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
December 18, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Go Science 100 pts. 11,459
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,372
  3. Avatar for Contenders 3. Contenders 44 pts. 11,206
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,953
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 10,644
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,610
  7. Avatar for Australia 7. Australia 5 pts. 10,558
  8. Avatar for VeFold 8. VeFold 3 pts. 10,435
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,370
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 8,906

  1. Avatar for Dr.Sillem 42. Dr.Sillem Lv 1 1 pt. 8,802
  2. Avatar for Mohoernchen 43. Mohoernchen Lv 1 1 pt. 8,684
  3. Avatar for DScott 44. DScott Lv 1 1 pt. 8,593
  4. Avatar for Trajan464 45. Trajan464 Lv 1 1 pt. 8,522
  5. Avatar for Savas 46. Savas Lv 1 1 pt. 8,421
  6. Avatar for M1M 47. M1M Lv 1 1 pt. 8,419
  7. Avatar for rinze 48. rinze Lv 1 1 pt. 8,335
  8. Avatar for zbp 49. zbp Lv 1 1 pt. 8,331
  9. Avatar for frostschutz 50. frostschutz Lv 1 1 pt. 8,239

Comments