Icon representing a puzzle

2549: Revisiting Puzzle 86: Nematode

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
December 18, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,459
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,372
  3. Avatar for Contenders 3. Contenders 44 pts. 11,206
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,953
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 10,644
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,610
  7. Avatar for Australia 7. Australia 5 pts. 10,558
  8. Avatar for VeFold 8. VeFold 3 pts. 10,435
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,370
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 8,906
  1. Avatar for HelpME 51. HelpME Lv 1 1 pt. 8,219
  2. Avatar for nancy_naniewoo 52. nancy_naniewoo Lv 1 1 pt. 8,208
  3. Avatar for zo3xiaJonWeinberg 53. zo3xiaJonWeinberg Lv 1 1 pt. 8,044
  4. Avatar for kitsoune 54. kitsoune Lv 1 1 pt. 7,986
  5. Avatar for KaDi 55. KaDi Lv 1 1 pt. 7,962
  6. Avatar for Anfinsen_slept_here 56. Anfinsen_slept_here Lv 1 1 pt. 7,944
  7. Avatar for Pinteger 57. Pinteger Lv 1 1 pt. 7,934
  8. Avatar for furi0us 58. furi0us Lv 1 1 pt. 7,886
  9. Avatar for harvardman 59. harvardman Lv 1 1 pt. 7,831
  10. Avatar for Sammy3c2b1a0 60. Sammy3c2b1a0 Lv 1 1 pt. 7,725

Comments