Icon representing a puzzle

2558: Revisiting Puzzle 89: Cow Eye

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,647
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 10,555
  3. Avatar for Gargleblasters 13. Gargleblasters 1 pt. 10,422
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,517
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,160
  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 11,332
  2. Avatar for Punzi Baker 3 2. Punzi Baker 3 Lv 1 94 pts. 11,326
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 87 pts. 11,324
  4. Avatar for LociOiling 4. LociOiling Lv 1 81 pts. 11,316
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 75 pts. 11,314
  6. Avatar for grogar7 6. grogar7 Lv 1 70 pts. 11,304
  7. Avatar for meatexplosion 7. meatexplosion Lv 1 65 pts. 11,299
  8. Avatar for gmn 8. gmn Lv 1 60 pts. 11,280
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 56 pts. 11,269
  10. Avatar for akaaka 10. akaaka Lv 1 51 pts. 11,268

Comments