Icon representing a puzzle

2558: Revisiting Puzzle 89: Cow Eye

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
January 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Go Science 100 pts. 11,333
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,316
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,314
  4. Avatar for Contenders 4. Contenders 30 pts. 11,269
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 11,189
  6. Avatar for Australia 6. Australia 11 pts. 11,174
  7. Avatar for VeFold 7. VeFold 7 pts. 11,090
  8. Avatar for Kotocycle 8. Kotocycle 4 pts. 11,047
  9. Avatar for Russian team 9. Russian team 2 pts. 10,904
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,844

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 11,332
  2. Avatar for Punzi Baker 3 2. Punzi Baker 3 Lv 1 94 pts. 11,326
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 87 pts. 11,324
  4. Avatar for LociOiling 4. LociOiling Lv 1 81 pts. 11,316
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 75 pts. 11,314
  6. Avatar for grogar7 6. grogar7 Lv 1 70 pts. 11,304
  7. Avatar for meatexplosion 7. meatexplosion Lv 1 65 pts. 11,299
  8. Avatar for gmn 8. gmn Lv 1 60 pts. 11,280
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 56 pts. 11,269
  10. Avatar for akaaka 10. akaaka Lv 1 51 pts. 11,268

Comments