Placeholder image of a protein
Icon representing a puzzle

2560: Electron Density Reconstruction 104

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
January 09, 2025
Expires
Max points
100
Description

We're going to take a break from the Refine Density puzzles to do a more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's rather large, so we definitely recommend the trim tool on this one. There's also a number of residues missing in this particular case.

Sequence
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN. FHCVPRDLSWLDLEANMCLP

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 34,682
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 42,690
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 42,513
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 88 pts. 42,477
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 82 pts. 42,466
  5. Avatar for spvincent 5. spvincent Lv 1 76 pts. 42,357
  6. Avatar for blazegeek 6. blazegeek Lv 1 71 pts. 42,255
  7. Avatar for gmn 7. gmn Lv 1 66 pts. 42,239
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 61 pts. 42,220
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 57 pts. 42,153
  10. Avatar for BootsMcGraw 10. BootsMcGraw Lv 1 53 pts. 42,101

Comments