Placeholder image of a protein
Icon representing a puzzle

2563: Electron Density Reconstruction 105

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
January 15, 2025
Expires
Max points
100
Description

We're going to take a break from the Refine Density puzzles to do another more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a bit large, so we would recommend the trim tool on this one.

Sequence
ASGFNAAEDAQTLRKAMKGLGTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQVILGMMTPTVLYDVQEVRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 22,855

  1. Avatar for georg137 21. georg137 Lv 1 16 pts. 36,586
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 14 pts. 36,480
  3. Avatar for jamiexq 23. jamiexq Lv 1 13 pts. 36,354
  4. Avatar for Anfinsen_slept_here 24. Anfinsen_slept_here Lv 1 11 pts. 36,257
  5. Avatar for JuliaBCollet 25. JuliaBCollet Lv 1 10 pts. 36,252
  6. Avatar for ShadowTactics 26. ShadowTactics Lv 1 9 pts. 36,191
  7. Avatar for alcor29 27. alcor29 Lv 1 8 pts. 36,171
  8. Avatar for NPrincipi 28. NPrincipi Lv 1 7 pts. 36,093
  9. Avatar for Ikuso 29. Ikuso Lv 1 6 pts. 36,075
  10. Avatar for Museka 30. Museka Lv 1 5 pts. 35,947

Comments